SFTPB anticorps (Middle Region)

N° du produit ABIN633984

Détail du produit anti-SFTPB anticorps

Antigène: SFTPB (Surfactant Protein B (SFTPB))

Épitope: Middle Region

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SFTPB est non-conjugé

Application: Western Blotting (WB)

Specificité: SFTPB antibody was raised against the middle region of SFTPB

Purification: Affinity purified

Immunogène: SFTPB antibody was raised using the middle region of SFTPB corresponding to a region with amino acids PGALQARPGPHTQDLSEQQFPIPLPYCWLCRALIKRIQAMIPKGALAVAV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SFTPB Blocking Peptide, catalog no. 33R-7093, is also available for use as a blocking control in assays to test for specificity of this SFTPB antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFTPB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SFTPB

Antigène: SFTPB (Surfactant Protein B (SFTPB))

Autre désignation: SFTPB (SFTPB Produits)

Synonymes: anticorps PSP-B, anticorps SFTB3, anticorps SFTP3, anticorps SMDP1, anticorps SP-B, anticorps AI562151, anticorps SF-B, anticorps Sftp-3, anticorps Sftp3, anticorps Sp-b, anticorps SFTPB, anticorps sftpb, anticorps xSP-B, anticorps surfactant protein B, anticorps surfactant associated protein B, anticorps surfactant, pulmonary-associated protein B L homeolog, anticorps SFTPB, anticorps Sftpb, anticorps sftpb.L

Sujet: SFTPB is the pulmonary-associated surfactant B protein (SPB), an amphipathic surfactant protein essential for lung function and homeostasis after birth. Pulmonary surfactant is a lipid-rich material that prevents lung collapse by lowering surface tension at the air-liquid interface in the alveoli of lung. SPB enhances the rate of spreading and increases the stability of surfactant monolayers in vitro. Surfactant is composed of phospholipids and other surfactant-associated proteins.

Poids moléculaire: 42 kDa (MW of target protein)