CETP anticorps (Middle Region)

N° du produit ABIN633988

Détail du produit anti-CETP anticorps

Antigène: CETP (Cholesteryl Ester Transfer Protein (CETP))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CETP est non-conjugé

Application: Western Blotting (WB)

Specificité: CETP antibody was raised against the middle region of CETP

Purification: Affinity purified

Immunogène: CETP antibody was raised using the middle region of CETP corresponding to a region with amino acids KKLFLSLLDFQITPKTVSNLTESSSESVQSFLQSMITAVGIPEVMSRLEV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CETP Blocking Peptide, catalog no. 33R-4481, is also available for use as a blocking control in assays to test for specificity of this CETP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CETP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CETP

Antigène: CETP (Cholesteryl Ester Transfer Protein (CETP))

Autre désignation: CETP (CETP Produits)

Synonymes: anticorps BPIFF, anticorps HDLCQ10, anticorps hdlcq10, anticorps cholesteryl ester transfer protein, anticorps cholesteryl ester transfer protein L homeolog, anticorps CETP, anticorps cetp.L, anticorps Cetp

Sujet: CETP involved in the transfer of insoluble cholesteryl esters in the reverse transport of cholesterol. Defects in CETP are a cause of hyperalphalipoproteinemia. Cholesteryl ester transfer protein (CETP) transfers cholesteryl esters between lipoproteins. CETP may effect susceptibility to atherosclerosis.

Poids moléculaire: 53 kDa (MW of target protein)