PLA1A anticorps (Middle Region)

N° du produit ABIN634039

Cet anticorps Lapin Polyclonal détecte spécifiquement PLA1A dans WB. Il présente une réactivité avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour PLA1A anticorps (Middle Region) (ABIN634039)

Antigène: PLA1A (Phospholipase A1 Member A (PLA1A))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PLA1A est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PLA1A anticorps

Épitope: Middle Region

Specificité: PLA1 A antibody was raised against the middle region of PLA1

Purification: Affinity purified

Immunogène: PLA1 A antibody was raised using the middle region of PLA1 corresponding to a region with amino acids TDTDNLGIRIPVGHVDYFVNGGQDQPGCPTFFYAGYSYLICDHMRAVHLY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PLA1A Blocking Peptide, (ABIN5615401), is also available for use as a blocking control in assays to test for specificity of this PLA1A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLA0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PLA1A

Antigène: PLA1A (Phospholipase A1 Member A (PLA1A))

Autre désignation: PLA1A

Sujet: Phosphatidylserine-specific phospholipase A1-alpha (PLA1A) acts specifically on phosphatidylserine (PS) and 1-acyl-2-lysophosphatidylserine (lyso-PS) to hydrolyze fatty acids at the sn-1 position of these phospholipids.

Poids moléculaire: 50 kDa (MW of target protein)