PLA1A anticorps (Middle Region)
-
- Antigène Voir toutes PLA1A Anticorps
- PLA1A (Phospholipase A1 Member A (PLA1A))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PLA1A est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PLA1 A antibody was raised against the middle region of PLA1
- Purification
- Affinity purified
- Immunogène
- PLA1 A antibody was raised using the middle region of PLA1 corresponding to a region with amino acids TDTDNLGIRIPVGHVDYFVNGGQDQPGCPTFFYAGYSYLICDHMRAVHLY
- Top Product
- Discover our top product PLA1A Anticorps primaire
-
anti-Phospholipase A1 Member A (PLA1A) (AA 309-452) antibody
PLA1A Reactivité: Humain WB, IHC, IP, ICC Hôte: Lapin Polyclonal unconjugated
anti-Phospholipase A1 Member A (PLA1A) (AA 293-398) antibodyPLA1A Reactivité: Humain WB, ELISA, IHC Hôte: Lapin Polyclonal unconjugated
anti-Phospholipase A1 Member A (PLA1A) (AA 1-456) antibodyPLA1A Reactivité: Humain WB, IP Hôte: Lapin Polyclonal unconjugated
anti-Phospholipase A1 Member A (PLA1A) (C-Term) antibodyPLA1A Reactivité: Humain WB, ELISA, IHC Hôte: Lapin Polyclonal unconjugated
anti-Phospholipase A1 Member A (PLA1A) (AA 329-358) antibodyPLA1A Reactivité: Humain, Souris WB Hôte: Lapin Polyclonal RB24179 unconjugated
anti-Phospholipase A1 Member A (PLA1A) (AA 241-340) antibodyPLA1A Reactivité: Humain WB, ELISA Hôte: Souris Polyclonal unconjugated
anti-Phospholipase A1 Member A (PLA1A) (AA 1-456) antibodyPLA1A Reactivité: Humain WB Hôte: Souris Polyclonal unconjugated
anti-Phospholipase A1 Member A (PLA1A) (Internal Region) antibodyPLA1A Reactivité: Humain, Souris, Rat WB, ELISA, ICC, IF Hôte: Lapin Polyclonal unconjugated
anti-Phospholipase A1 Member A (PLA1A) (AA 148-295) antibodyPLA1A Reactivité: Humain WB, IHC, ICC Hôte: Lapin Polyclonal unconjugated
anti-Phospholipase A1 Member A (PLA1A) (Middle Region) antibodyPLA1A Reactivité: Humain, Souris, Rat, Boeuf (Vache), Chien, Cobaye, Cheval, Lapin, Poisson zèbre (Danio rerio) WB Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PLA1A Blocking Peptide, catalog no. 33R-9022, is also available for use as a blocking control in assays to test for specificity of this PLA1A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLA0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PLA1A (Phospholipase A1 Member A (PLA1A))
- Autre désignation
- PLA1A (PLA1A Produits)
- Synonymes
- anticorps PS-PLA1, anticorps PSPLA1, anticorps AA986889, anticorps Ps-pla1, anticorps Pspla1, anticorps wu:fi26h09, anticorps zgc:77160, anticorps AH, anticorps ARWH2, anticorps LAH2, anticorps LPDLR, anticorps PLA1B, anticorps mPA-PLA1, anticorps phospholipase A1 member A, anticorps lipase H, anticorps PLA1A, anticorps Pla1a, anticorps pla1a, anticorps CpipJ_CPIJ002492, anticorps CpipJ_CPIJ007883, anticorps LIPH
- Sujet
- Phosphatidylserine-specific phospholipase A1-alpha (PLA1A) acts specifically on phosphatidylserine (PS) and 1-acyl-2-lysophosphatidylserine (lyso-PS) to hydrolyze fatty acids at the sn-1 position of these phospholipids.
- Poids moléculaire
- 50 kDa (MW of target protein)
-
