DHRS9 anticorps

N° du produit ABIN634049

Détail du produit anti-DHRS9 anticorps

Antigène: DHRS9 (Dehydrogenase/reductase (SDR Family) Member 9 (DHRS9))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DHRS9 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: DHRS9 antibody was raised using a synthetic peptide corresponding to a region with amino acids DPVKVIEKKLAIWEQLSPDIKQQYGEGYIEKSLDKLKGNKSYVNMDLSPV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DHRS9 Blocking Peptide, catalog no. 33R-2120, is also available for use as a blocking control in assays to test for specificity of this DHRS9 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHRS9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DHRS9

Antigène: DHRS9 (Dehydrogenase/reductase (SDR Family) Member 9 (DHRS9))

Autre désignation: DHRS9 (DHRS9 Produits)

Synonymes: anticorps 3ALPHA-HSD, anticorps RDH-TBE, anticorps RDH15, anticorps RDHL, anticorps RDHTBE, anticorps RETSDR8, anticorps SDR9C4, anticorps Rdhl, anticorps C730025I08Rik, anticorps Rdh15, anticorps rdhl, anticorps 3alpha-hsd, anticorps rdh15, anticorps retsdr8, anticorps DHRS9, anticorps RDHA, anticorps rdh1l, anticorps wu:fb64b07, anticorps zgc:73286, anticorps dehydrogenase/reductase 9, anticorps dehydrogenase/reductase (SDR family) member 9, anticorps dehydrogenase/reductase (SDR family) member 9 L homeolog, anticorps DHRS9, anticorps Dhrs9, anticorps dhrs9.L, anticorps dhrs9

Sujet: DHRS9 is a 3-alpha-hydroxysteroid dehydrogenase that converts 3-alpha-tetrahydroprogesterone (allopregnanolone) to dihydroxyprogesterone and 3-alpha-androstanediol to dihydroxyprogesterone.

Poids moléculaire: 35 kDa (MW of target protein)

Pathways: C21-Steroid Hormone Metabolic Process