SERPINI2 anticorps

N° du produit ABIN634053

Détail du produit anti-SERPINI2 anticorps

Antigène: SERPINI2 (serpin Peptidase Inhibitor, Clade I (Pancpin), Member 2 (SERPINI2))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SERPINI2 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: SERPINI2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LPRFKVEQKVDFKDVLYSLNITEIFSGGCDLSGITDSSEVYVSQVTQKVF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SERPINI2 Blocking Peptide, catalog no. 33R-5285, is also available for use as a blocking control in assays to test for specificity of this SERPINI2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SERPINI2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SERPINI2

Antigène: SERPINI2 (serpin Peptidase Inhibitor, Clade I (Pancpin), Member 2 (SERPINI2))

Autre désignation: SERPINI2 (SERPINI2 Produits)

Synonymes: anticorps Spi14, anticorps MEPI, anticorps PANCPIN, anticorps PI14, anticorps TSA2004, anticorps serpin family I member 2, anticorps serpin peptidase inhibitor, clade I (pancpin), member 2 L homeolog, anticorps serpin peptidase inhibitor, clade I (pancpin), member 2, anticorps serine (or cysteine) peptidase inhibitor, clade I, member 2, anticorps SERPINI2, anticorps serpini2.L, anticorps Serpini2

Sujet: The protein encoded by this gene is a member of the serine protease inhibitor (serpin) superfamily made up of proteins which play central roles in the regulation of a wide variety of physiological processes, including coagulation and fibrinolysis.

Poids moléculaire: 46 kDa (MW of target protein)