CDT1 anticorps (C-Term)

N° du produit ABIN634110

Cet anticorps anti-CDT1 est un anticorps Lapin Polyclonal détectant CDT1 dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour CDT1 anticorps (C-Term) (ABIN634110)

Antigène: CDT1 (Chromatin Licensing and DNA Replication Factor 1 (CDT1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CDT1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-CDT1 anticorps

Épitope: C-Term

Specificité: CDT1 antibody was raised against the C terminal of CDT1

Purification: Affinity purified

Immunogène: CDT1 antibody was raised using the C terminal of CDT1 corresponding to a region with amino acids PATPPATPPAASPSALKGVSQDLLERIRAKEAQKQLAQMTRCPEQEQRLQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CDT1 Blocking Peptide, (ABIN5612807), is also available for use as a blocking control in assays to test for specificity of this CDT1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CDT1

Antigène: CDT1 (Chromatin Licensing and DNA Replication Factor 1 (CDT1))

Autre désignation: CDT1

Sujet: CDT1 cooperates with CDC6 to promote the loading of the mini-chromosome maintenance complex onto chromatin to form the pre-replication complex necessary to initiate DNA replication.

Poids moléculaire: 60 kDa (MW of target protein)

Pathways: Signalisation MAPK, Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA