CDT1 anticorps (C-Term)

N° du produit ABIN634110

Détail du produit anti-CDT1 anticorps

Antigène: CDT1 (Chromatin Licensing and DNA Replication Factor 1 (CDT1))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CDT1 est non-conjugé

Application: Western Blotting (WB)

Specificité: CDT1 antibody was raised against the C terminal of CDT1

Purification: Affinity purified

Immunogène: CDT1 antibody was raised using the C terminal of CDT1 corresponding to a region with amino acids PATPPATPPAASPSALKGVSQDLLERIRAKEAQKQLAQMTRCPEQEQRLQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CDT1 Blocking Peptide, catalog no. 33R-6985, is also available for use as a blocking control in assays to test for specificity of this CDT1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CDT1

Antigène: CDT1 (Chromatin Licensing and DNA Replication Factor 1 (CDT1))

Autre désignation: CDT1 (CDT1 Produits)

Synonymes: anticorps CDT1, anticorps fc37h07, anticorps im:7158083, anticorps wu:fc37h07, anticorps wu:fi38h09, anticorps xcdt1, anticorps DUP, anticorps RIS2, anticorps 2610318F11Rik, anticorps AW545653, anticorps C76791, anticorps Ris2, anticorps dup, anticorps ris2, anticorps chromatin licensing and DNA replication factor 1, anticorps chromatin licensing and DNA replication factor 1 L homeolog, anticorps CDT1, anticorps cdt1, anticorps Cdt1, anticorps cdt1.L

Sujet: CDT1 cooperates with CDC6 to promote the loading of the mini-chromosome maintenance complex onto chromatin to form the pre-replication complex necessary to initiate DNA replication.

Poids moléculaire: 60 kDa (MW of target protein)

Pathways: Signalisation MAPK, Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA