KIF15 anticorps (Middle Region)

N° du produit ABIN634134

Détail du produit anti-KIF15 anticorps

Antigène: KIF15 (Kinesin Family Member 15 (KIF15))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KIF15 est non-conjugé

Application: Western Blotting (WB)

Specificité: KIF15 antibody was raised against the middle region of KIF15

Purification: Affinity purified

Immunogène: KIF15 antibody was raised using the middle region of KIF15 corresponding to a region with amino acids SKKHSGLLQSAQEELTKKEALIQELQHKLNQKKEEVEQKKNEYNFKMRQL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KIF15 Blocking Peptide, catalog no. 33R-8556, is also available for use as a blocking control in assays to test for specificity of this KIF15 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIF15 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KIF15

Antigène: KIF15 (Kinesin Family Member 15 (KIF15))

Autre désignation: KIF15 (KIF15 Produits)

Synonymes: anticorps XKlp2, anticorps kif15, anticorps klp2, anticorps KIF15, anticorps si:dkey-108k21.1, anticorps wu:fb96c12, anticorps wu:fc51g12, anticorps wu:fe01e02, anticorps HKLP2, anticorps KNSL7, anticorps NY-BR-62, anticorps 3110023M17Rik, anticorps 3930402I10Rik, anticorps D330038N01, anticorps Knsl7, anticorps b2b1117.1Clo, anticorps kinesin family member 15 L homeolog, anticorps kinesin family member 15, anticorps kinesin family member 15 S homeolog, anticorps zinc finger protein 660, anticorps kif15.L, anticorps KIF15, anticorps kif15.S, anticorps kif15, anticorps Kif15, anticorps ZNF660

Sujet: KIF15 is the plus-end directed kinesin-like motor enzyme involved in mitotic spindle assembly.

Poids moléculaire: 160 kDa (MW of target protein)