MAPK13 anticorps (Middle Region)

N° du produit ABIN634241

L’anticorps anti-MAPK13 Polyclonal Lapin est utilisé pour la détection de MAPK13 dans des échantillons de Humain, Souris et Rat. Il a été validé pour WB.

Aperçu rapide pour MAPK13 anticorps (Middle Region) (ABIN634241)

Antigène: MAPK13 (Mitogen-Activated Protein Kinase 13 (MAPK13))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MAPK13 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-MAPK13 anticorps

Épitope: Middle Region

Specificité: MAPK13 antibody was raised against the middle region of MAPK13

Purification: Affinity purified

Immunogène: MAPK13 antibody was raised using the middle region of MAPK13 corresponding to a region with amino acids KMLELDVDKRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MAPK13 Blocking Peptide, (ABIN939944), is also available for use as a blocking control in assays to test for specificity of this MAPK13 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAPK13 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MAPK13

Antigène: MAPK13 (Mitogen-Activated Protein Kinase 13 (MAPK13))

Autre désignation: MAPK13

Sujet: The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation and transcription.

Poids moléculaire: 42 kDa (MW of target protein)

Pathways: Signalisation MAPK, Neurotrophin Signaling Pathway, Hepatitis C, BCR Signaling, S100 Proteins