MAPK13 anticorps (Middle Region)

N° du produit ABIN634241

Détail du produit anti-MAPK13 anticorps

Antigène: MAPK13 (Mitogen-Activated Protein Kinase 13 (MAPK13))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MAPK13 est non-conjugé

Application: Western Blotting (WB)

Specificité: MAPK13 antibody was raised against the middle region of MAPK13

Purification: Affinity purified

Immunogène: MAPK13 antibody was raised using the middle region of MAPK13 corresponding to a region with amino acids KMLELDVDKRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MAPK13 Blocking Peptide, catalog no. 33R-4558, is also available for use as a blocking control in assays to test for specificity of this MAPK13 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAPK13 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MAPK13

Antigène: MAPK13 (Mitogen-Activated Protein Kinase 13 (MAPK13))

Autre désignation: MAPK13 (MAPK13 Produits)

Synonymes: anticorps F24B9.3, anticorps F24B9_3, anticorps MAPK 13, anticorps MAPK-13, anticorps PRKM13, anticorps SAPK4, anticorps p38delta, anticorps Serk4, anticorps Prkm13, anticorps sapk4, anticorps prkm13, anticorps Protein kinase superfamily protein, anticorps mitogen-activated protein kinase 13, anticorps mitogen activated protein kinase 13, anticorps ATMPK13, anticorps MAPK13, anticorps Mapk13, anticorps mapk13

Sujet: The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation and transcription.

Poids moléculaire: 42 kDa (MW of target protein)

Pathways: Signalisation MAPK, Neurotrophin Signaling Pathway, Hepatitis C, BCR Signaling, S100 Proteins