Phospholipase C beta 1 anticorps

N° du produit ABIN634242

Cet anticorps anti-Phospholipase C beta 1 Polyclonal Lapin (ABIN634242) détecte spécifiquement Phospholipase C beta 1 dans WB. L’anticorps est réactif avec des échantillons de Humain et Souris.

Aperçu rapide pour Phospholipase C beta 1 anticorps (ABIN634242)

Antigène: Phospholipase C beta 1 (PLCB1) (phospholipase C, beta 1 (phosphoinositide-Specific) (PLCB1))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Phospholipase C beta 1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Phospholipase C beta 1 anticorps

Purification: Affinity purified

Immunogène: PLCB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids EAQSKRQEKLVEKHKEIRQQILDEKPKGEGSSSFLSETCHEDPSVSPNFT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PLCB1 Blocking Peptide, (ABIN937664), is also available for use as a blocking control in assays to test for specificity of this PLCB1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLCB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Phospholipase C beta 1

Antigène: Phospholipase C beta 1 (PLCB1) (phospholipase C, beta 1 (phosphoinositide-Specific) (PLCB1))

Autre désignation: PLCB1

Sujet: The protein encoded by this gene catalyzes the formation of inositol 1,4,5-trisphosphate and diacylglycerol from phosphatidylinositol 4,5-bisphosphate. This reaction uses calcium as a cofactor and plays an important role in intracellular transduction.

Poids moléculaire: 134 kDa (MW of target protein)

Pathways: Signalisation WNT, AMPK Signaling, Thyroid Hormone Synthesis, Inositol Metabolic Process, Regulation of Muscle Cell Differentiation, Regulation of G-Protein Coupled Receptor Protein Signaling, Proton Transport, Skeletal Muscle Fiber Development, CXCR4-mediated Signaling Events, G-protein mediated Events