MAPK12 anticorps (N-Term)

N° du produit ABIN634255

Cet anticorps Lapin Polyclonal détecte spécifiquement MAPK12 dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour MAPK12 anticorps (N-Term) (ABIN634255)

Antigène: MAPK12 (Mitogen-Activated Protein Kinase 12 (MAPK12))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MAPK12 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-MAPK12 anticorps

Épitope: N-Term

Specificité: MAPK12 antibody was raised against the N terminal of MAPK12

Purification: Affinity purified

Immunogène: MAPK12 antibody was raised using the N terminal of MAPK12 corresponding to a region with amino acids SGAYGAVCSAVDGRTGAKVAIKKLYRPFQSELFAKRAYRELRLLKHMRHE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MAPK12 Blocking Peptide, (ABIN5614663), is also available for use as a blocking control in assays to test for specificity of this MAPK12 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAPK12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MAPK12

Antigène: MAPK12 (Mitogen-Activated Protein Kinase 12 (MAPK12))

Autre désignation: MAPK12

Sujet: Activation of members of the mitogen-activated protein kinase family is a major mechanism for transduction of extracellular signals. Stress-activated protein kinases are one subclass of MAP kinases.

Poids moléculaire: 42 kDa (MW of target protein)

Pathways: Signalisation MAPK, Neurotrophin Signaling Pathway, Regulation of Muscle Cell Differentiation, Hepatitis C, BCR Signaling, S100 Proteins