MAPK12 anticorps (N-Term)

N° du produit ABIN634255

Détail du produit anti-MAPK12 anticorps

Antigène: MAPK12 (Mitogen-Activated Protein Kinase 12 (MAPK12))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MAPK12 est non-conjugé

Application: Western Blotting (WB)

Specificité: MAPK12 antibody was raised against the N terminal of MAPK12

Purification: Affinity purified

Immunogène: MAPK12 antibody was raised using the N terminal of MAPK12 corresponding to a region with amino acids SGAYGAVCSAVDGRTGAKVAIKKLYRPFQSELFAKRAYRELRLLKHMRHE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MAPK12 Blocking Peptide, catalog no. 33R-8447, is also available for use as a blocking control in assays to test for specificity of this MAPK12 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAPK12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MAPK12

Antigène: MAPK12 (Mitogen-Activated Protein Kinase 12 (MAPK12))

Autre désignation: MAPK12 (MAPK12 Produits)

Synonymes: anticorps ATMPK12, anticorps MAPK12, anticorps T3F17.28, anticorps mitogen-activated protein kinase 12, anticorps MGC160082, anticorps si:dkey-14d8.5, anticorps erk6, anticorps etID309866.18, anticorps mapk12, anticorps sapk3, anticorps wu:fa05c12, anticorps zgc:101695, anticorps ERK3, anticorps ERK6, anticorps P38GAMMA, anticorps PRKM12, anticorps SAPK-3, anticorps SAPK3, anticorps AW123708, anticorps Erk6, anticorps P38gamma, anticorps Prkm12, anticorps Sapk3, anticorps mitogen-activated protein kinase 12, anticorps mitogen-activated protein kinase 12b, anticorps mitogen-activated protein kinase 12a, anticorps MPK12, anticorps MAPK12, anticorps mapk12b, anticorps mapk12a, anticorps Mapk12

Sujet: Activation of members of the mitogen-activated protein kinase family is a major mechanism for transduction of extracellular signals. Stress-activated protein kinases are one subclass of MAP kinases.

Poids moléculaire: 42 kDa (MW of target protein)

Pathways: Signalisation MAPK, Neurotrophin Signaling Pathway, Regulation of Muscle Cell Differentiation, Hepatitis C, BCR Signaling, S100 Proteins