EXT2 anticorps

N° du produit ABIN634281

Détail du produit anti-EXT2 anticorps

Antigène: EXT2 (Exostosin 2 (EXT2))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EXT2 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: EXT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids NELLMAISDSDYYTDDINRACLFVPSIDVLNQNTLRIKETAQAMAQLSRW

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EXT2 Blocking Peptide, catalog no. 33R-6672, is also available for use as a blocking control in assays to test for specificity of this EXT2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EXT2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur EXT2

Antigène: EXT2 (Exostosin 2 (EXT2))

Autre désignation: EXT2 (EXT2 Produits)

Synonymes: anticorps SOTV, anticorps AI893565, anticorps EXT2, anticorps ext2, anticorps exostosin glycosyltransferase 2, anticorps exostoses (multiple) 2, anticorps exostoses (multiple) 3, anticorps exostosin glycosyltransferase 2 L homeolog, anticorps EXT2, anticorps Ext2, anticorps EXT3, anticorps ext2.L

Sujet: EXT2 is one of two glycosyltransferases involved in the chain elongation step of heparan sulfate biosynthesis.

Poids moléculaire: 82 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process