EXT2 anticorps
-
- Antigène Voir toutes EXT2 Anticorps
- EXT2 (Exostosin 2 (EXT2))
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp EXT2 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- EXT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids NELLMAISDSDYYTDDINRACLFVPSIDVLNQNTLRIKETAQAMAQLSRW
- Top Product
- Discover our top product EXT2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
EXT2 Blocking Peptide, catalog no. 33R-6672, is also available for use as a blocking control in assays to test for specificity of this EXT2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EXT2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- EXT2 (Exostosin 2 (EXT2))
- Autre désignation
- EXT2 (EXT2 Produits)
- Synonymes
- anticorps SOTV, anticorps AI893565, anticorps EXT2, anticorps ext2, anticorps exostosin glycosyltransferase 2, anticorps exostoses (multiple) 2, anticorps exostoses (multiple) 3, anticorps exostosin glycosyltransferase 2 L homeolog, anticorps EXT2, anticorps Ext2, anticorps EXT3, anticorps ext2.L
- Sujet
- EXT2 is one of two glycosyltransferases involved in the chain elongation step of heparan sulfate biosynthesis.
- Poids moléculaire
- 82 kDa (MW of target protein)
- Pathways
- Glycosaminoglycan Metabolic Process
-