SQSTM1 anticorps (Middle Region)

N° du produit ABIN634293

Cet anticorps anti-SQSTM1 Polyclonal Lapin (ABIN634293) détecte spécifiquement SQSTM1 dans WB. L’anticorps est réactif avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour SQSTM1 anticorps (Middle Region) (ABIN634293)

Antigène: SQSTM1 (Sequestosome 1 (SQSTM1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SQSTM1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SQSTM1 anticorps

Épitope: Middle Region

Specificité: Sequestosome 1 antibody was raised against the middle region of SQSTM1

Purification: Affinity purified

Immunogène: Sequestosome 1 antibody was raised using the middle region of SQSTM1 corresponding to a region with amino acids EEQMESDNCSGGDDDWTHLSSKEVDPSTGELQSLQMPESEGPSSLDPSQE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Sequestosome 1 Blocking Peptide, (ABIN937769), is also available for use as a blocking control in assays to test for specificity of this Sequestosome 1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SQSTM1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SQSTM1

Antigène: SQSTM1 (Sequestosome 1 (SQSTM1))

Autre désignation: Sequestosome 1

Sujet: This gene encodes a multifunctional protein that binds ubiquitin and regulates activation of the nuclear factor kappa-B (NF-kB) signaling pathway. The protein functions as a scaffolding/adaptor protein.

Poids moléculaire: 48 kDa (MW of target protein)

Pathways: Signalisation NF-kappaB, Neurotrophin Signaling Pathway, Autophagy