RALGPS1 anticorps (Middle Region)

N° du produit ABIN634297

Détail du produit anti-RALGPS1 anticorps

Antigène: RALGPS1 (Ral GEF with PH Domain and SH3 Binding Motif 1 (RALGPS1))

Épitope: Middle Region

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RALGPS1 est non-conjugé

Application: Western Blotting (WB)

Specificité: RALGPS1 antibody was raised against the middle region of RALGPS1

Purification: Affinity purified

Immunogène: RALGPS1 antibody was raised using the middle region of RALGPS1 corresponding to a region with amino acids AGSLPTPPVPRHRKSHSLGNNMMCQLSVVESKSATFPSEKARHLLDDSVL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RALGPS1 Blocking Peptide, catalog no. 33R-1222, is also available for use as a blocking control in assays to test for specificity of this RALGPS1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RALGPS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RALGPS1

Antigène: RALGPS1 (Ral GEF with PH Domain and SH3 Binding Motif 1 (RALGPS1))

Autre désignation: RALGPS1 (RALGPS1 Produits)

Synonymes: anticorps RALGEF2, anticorps RALGPS1A, anticorps si:dkey-191c17.1, anticorps zgc:165535, anticorps 5830418G11Rik, anticorps AI853783, anticorps AI854138, anticorps RalGEF 2, anticorps mKIAA0351, anticorps Ral GEF with PH domain and SH3 binding motif 1, anticorps RALGPS1, anticorps ralgps1, anticorps Ralgps1

Sujet: RALGPS1 contains 1 PH domain and 1 Ras-GEF domain. RALGPS1 may be involved in cytoskeletal organization. It may also be involved in the stimulation of transcription in a Ras-independent fashion Guanine nucleotide exchange factor for the small GTPase RALA.

Poids moléculaire: 62 kDa (MW of target protein)