JAK3 anticorps

N° du produit ABIN634320

Cet anticorps anti-JAK3 Polyclonal Lapin (ABIN634320) détecte spécifiquement JAK3 dans WB. L’anticorps est réactif avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour JAK3 anticorps (ABIN634320)

Antigène: JAK3 (Janus Kinase 3 (JAK3))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp JAK3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-JAK3 anticorps

Purification: Affinity purified

Immunogène: JAK3 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLLPLDKDYYVVREPGQSPIFWYAPESLSDNIFSRQSDVWSFGVVLYELF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

JAK3 Blocking Peptide, (ABIN939905), is also available for use as a blocking control in assays to test for specificity of this JAK3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of JAK3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur JAK3

Antigène: JAK3 (Janus Kinase 3 (JAK3))

Autre désignation: JAK3

Sujet: JAK3 is a member of the Janus kinase (JAK) family of tyrosine kinases, which is involved in cytokine receptor-mediated intracellular signal transduction. JAK3 is predominantly expressed in immune cells and transduces a signal in response to its activation via tyrosine phosphorylation by interleukin receptors. Mutations in JAK3 are associated with autosomal SCID (severe combined immunodeficiency disease).

Poids moléculaire: 125 kDa (MW of target protein)

Pathways: Signalistation JAK/STAT, Signalisation RTK, Response to Growth Hormone Stimulus, Regulation of Leukocyte Mediated Immunity, Production of Molecular Mediator of Immune Response, Protein targeting to Nucleus, Activated T Cell Proliferation, Unfolded Protein Response