PHAP1 anticorps

N° du produit ABIN634324

Détail du produit anti-PHAP1 anticorps

Antigène: PHAP1 (ANP32A) (Acidic (Leucine-Rich) Nuclear phosphoprotein 32 Family, Member A (ANP32A))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PHAP1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Affinity purified

Immunogène: ANP32 A antibody was raised using a synthetic peptide corresponding to a region with amino acids FNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDE

Information d'application

Indications d'application: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ANP32A Blocking Peptide, catalog no. 33R-3001, is also available for use as a blocking control in assays to test for specificity of this ANP32A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANP30 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PHAP1

Antigène: PHAP1 (ANP32A) (Acidic (Leucine-Rich) Nuclear phosphoprotein 32 Family, Member A (ANP32A))

Autre désignation: ANP32A (ANP32A Produits)

Synonymes: anticorps C15orf1, anticorps HPPCn, anticorps I1PP2A, anticorps LANP, anticorps MAPM, anticorps PHAP1, anticorps PHAPI, anticorps PP32, anticorps Anp32, anticorps W91701, anticorps pp32, anticorps Anp32a, anticorps CG5784, anticorps CT18148, anticorps CT42180, anticorps Dmel\\CG5784, anticorps anon-EST:fe3A2, anticorps wu:fj36e08, anticorps zgc:55516, anticorps ANP32D, anticorps acidic nuclear phosphoprotein 32 family member A, anticorps acidic (leucine-rich) nuclear phosphoprotein 32 family, member A, anticorps CG5784 gene product from transcript CG5784-RB, anticorps acidic nuclear phosphoprotein 32 family member A L homeolog, anticorps ANP32A, anticorps Anp32a, anticorps Mapmodulin, anticorps anp32a, anticorps anp32a.L

Sujet: ANP32A is a novel potent heat-stable inhibitor protein of protein phosphatase 2A. It may play a key role in self-renewing cell populations where it may act in the nucleus to limit their sensitivity to transformation. Being a tumor suppressor, ANP32A represses cell growth through inhibition of transcription by blocking acetylation and phosphorylation of histone H3 and initiating its proapoptotic activity.

Poids moléculaire: 29 kDa (MW of target protein)