DGKH anticorps (Middle Region)

N° du produit ABIN634354

Détail du produit anti-DGKH anticorps

Antigène: DGKH (Diacylglycerol Kinase, eta (DGKH))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DGKH est non-conjugé

Application: Western Blotting (WB)

Specificité: DGKH antibody was raised against the middle region of DGKH

Purification: Affinity purified

Immunogène: DGKH antibody was raised using the middle region of DGKH corresponding to a region with amino acids DLDSVDGYSEKCVMNNYFGIGLDAKISLEFNNKREEHPEKCRSRTKNLMW

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DGKH Blocking Peptide, catalog no. 33R-2038, is also available for use as a blocking control in assays to test for specificity of this DGKH antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DGKH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DGKH

Antigène: DGKH (Diacylglycerol Kinase, eta (DGKH))

Autre désignation: DGKH (DGKH Produits)

Synonymes: anticorps DGKeta, anticorps 5930402B05Rik, anticorps D130015C16, anticorps DGKH, anticorps RGD1561955, anticorps si:ch211-93a19.1, anticorps diacylglycerol kinase eta, anticorps diacylglycerol kinase, eta, anticorps DGKH, anticorps Dgkh, anticorps LOC100546131, anticorps dgkh

Sujet: DGKH is a member of the diacylglycerol kinase (DGK) enzyme family of proteins, specifically the type II DGK subfamily. Members of this family are involved in regulating the intracellular concentrations of diacylglycerol and phosphatidic acid.

Poids moléculaire: 135 kDa (MW of target protein)