DGKH anticorps (Middle Region)
-
- Antigène Voir toutes DGKH Anticorps
- DGKH (Diacylglycerol Kinase, eta (DGKH))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp DGKH est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- DGKH antibody was raised against the middle region of DGKH
- Purification
- Affinity purified
- Immunogène
- DGKH antibody was raised using the middle region of DGKH corresponding to a region with amino acids DLDSVDGYSEKCVMNNYFGIGLDAKISLEFNNKREEHPEKCRSRTKNLMW
- Top Product
- Discover our top product DGKH Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
DGKH Blocking Peptide, catalog no. 33R-2038, is also available for use as a blocking control in assays to test for specificity of this DGKH antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DGKH antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- DGKH (Diacylglycerol Kinase, eta (DGKH))
- Autre désignation
- DGKH (DGKH Produits)
- Synonymes
- anticorps DGKeta, anticorps 5930402B05Rik, anticorps D130015C16, anticorps DGKH, anticorps RGD1561955, anticorps si:ch211-93a19.1, anticorps diacylglycerol kinase eta, anticorps diacylglycerol kinase, eta, anticorps DGKH, anticorps Dgkh, anticorps LOC100546131, anticorps dgkh
- Sujet
- DGKH is a member of the diacylglycerol kinase (DGK) enzyme family of proteins, specifically the type II DGK subfamily. Members of this family are involved in regulating the intracellular concentrations of diacylglycerol and phosphatidic acid.
- Poids moléculaire
- 135 kDa (MW of target protein)
-