CAP1 anticorps
-
- Antigène Voir toutes CAP1 Anticorps
- CAP1 (CAP, Adenylate Cyclase-Associated Protein 1 (CAP1))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CAP1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- CAP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MADMQNLVERLERAVGRLEAVSHTSDMHRGYADSPSKAGAAPYVQAFDSL
- Top Product
- Discover our top product CAP1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CAP1 Blocking Peptide, catalog no. 33R-5624, is also available for use as a blocking control in assays to test for specificity of this CAP1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CAP1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CAP1 (CAP, Adenylate Cyclase-Associated Protein 1 (CAP1))
- Autre désignation
- CAP1 (CAP1 Produits)
- Synonymes
- anticorps CAP, anticorps CAP1-PEN, anticorps CAP1, anticorps DKFZp459E1319, anticorps cap1, anticorps Mch1, anticorps fj98f01, anticorps zgc:63872, anticorps wu:fj98f01, anticorps cyclase associated actin cytoskeleton regulatory protein 1, anticorps adenylyl cyclase-associated protein 1, anticorps Cap1 CAP, adenylate cyclase-associated protein 1, anticorps CAP, adenylate cyclase-associated protein 1 (yeast), anticorps adenylate cyclase associated protein 1, anticorps adenylyl cyclase-associated protein Cap1, anticorps CAP1, anticorps LOC5580331, anticorps cap1, anticorps Cap1
- Sujet
- The protein encoded by this gene is related to the S. cerevisiae CAP protein, which is involved in the cyclic AMP pathway. The human protein is able to interact with other molecules of the same protein, as well as with CAP2 and actin.
- Poids moléculaire
- 52 kDa (MW of target protein)
- Pathways
- cAMP Metabolic Process
-