CAP1 anticorps

N° du produit ABIN634355

L’anticorps anti-CAP1 Polyclonal Lapin est utilisé pour la détection de CAP1 dans des échantillons de Humain, Souris et Rat. Il a été validé pour WB.

Aperçu rapide pour CAP1 anticorps (ABIN634355)

Antigène: CAP1 (CAP, Adenylate Cyclase-Associated Protein 1 (CAP1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CAP1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-CAP1 anticorps

Purification: Affinity purified

Immunogène: CAP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MADMQNLVERLERAVGRLEAVSHTSDMHRGYADSPSKAGAAPYVQAFDSL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CAP1 Blocking Peptide, (ABIN5612603), is also available for use as a blocking control in assays to test for specificity of this CAP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CAP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CAP1

Antigène: CAP1 (CAP, Adenylate Cyclase-Associated Protein 1 (CAP1))

Autre désignation: CAP1

Sujet: The protein encoded by this gene is related to the S. cerevisiae CAP protein, which is involved in the cyclic AMP pathway. The human protein is able to interact with other molecules of the same protein, as well as with CAP2 and actin.

Poids moléculaire: 52 kDa (MW of target protein)

Pathways: cAMP Metabolic Process