RASGRP2 anticorps

N° du produit ABIN634377

Cet anticorps anti-RASGRP2 est un anticorps Lapin Polyclonal détectant RASGRP2 dans WB. Adapté pour Humain et Rat.

Aperçu rapide pour RASGRP2 anticorps (ABIN634377)

Antigène: RASGRP2 (RAS Guanyl Releasing Protein 2 (Calcium and DAG-Regulated) (RASGRP2))

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RASGRP2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RASGRP2 anticorps

Purification: Affinity purified

Immunogène: RASGRP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LVRMFLMMHPWYIPSSQLAAKLLHIYQQSRKDNSNSLQVKTCHLVRYWIS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RASGRP2 Blocking Peptide, (ABIN5615768), is also available for use as a blocking control in assays to test for specificity of this RASGRP2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RASGRP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RASGRP2

Antigène: RASGRP2 (RAS Guanyl Releasing Protein 2 (Calcium and DAG-Regulated) (RASGRP2))

Autre désignation: RASGRP2

Sujet: The protein encoded by this gene is a brain-enriched nucleotide exchanged factor that contains an N-terminal GEF domain, 2 tandem repeats of EF-hand calcium-binding motifs, and a C-terminal diacylglycerol/phorbol ester-binding domain.

Poids moléculaire: 69 kDa (MW of target protein)

Pathways: TCR Signaling