MYD88 anticorps

N° du produit ABIN634398

Détail du produit anti-MYD88 anticorps

Antigène: MYD88 (Myeloid Differentiation Primary Response Gene (88) (MYD88))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MYD88 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: MYD88 antibody was raised using a synthetic peptide corresponding to a region with amino acids YLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MYD88 Blocking Peptide, catalog no. 33R-10165, is also available for use as a blocking control in assays to test for specificity of this MYD88 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MYD88 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MYD88

Antigène: MYD88 (Myeloid Differentiation Primary Response Gene (88) (MYD88))

Autre désignation: MYD88 (MYD88 Produits)

Synonymes: anticorps MYD88D, anticorps XMyD88, anticorps myd88d, anticorps MGC84928, anticorps CG2078, anticorps DMMYD88, anticorps DmMyD88, anticorps DmMyd88, anticorps Dmel\\CG2078, anticorps EP(2)2535, anticorps Kra, anticorps LD20892, anticorps MYD88, anticorps MyD88, anticorps Myd88F, anticorps dMyD88, anticorps dMyd88, anticorps kra, anticorps myd88, anticorps zgc:103541, anticorps GB12344, anticorps NV10640, anticorps myd88-a, anticorps myd88-b, anticorps myeloid differentiation primary response 88, anticorps myeloid differentiation primary response 88 S homeolog, anticorps myeloid differentiation primary response gene 88, anticorps CG2078 gene product from transcript CG2078-RB, anticorps myeloid differentiation primary response protein MyD88-A, anticorps myeloid differentiation primary response protein MyD88, anticorps myeloid differentiation factor 88, anticorps myeloid differentiation primary response 88 L homeolog, anticorps MYD88, anticorps myd88.S, anticorps Myd88, anticorps myd88, anticorps LOC413194, anticorps LOC100118553, anticorps LOC575153, anticorps myd88.L

Sujet: This gene encodes a cytosolic adapter protein that plays a central role in the innate and adaptive immune response. This protein functions as an essential signal transducer in the interleukin-1 and Toll-like receptor signaling pathways.

Poids moléculaire: 33 kDa (MW of target protein)

Pathways: Signalisation NF-kappaB, Signalisation TLR, Neurotrophin Signaling Pathway, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response, Toll-Like Receptors Cascades