LTA4H anticorps (Middle Region)
-
- Antigène Voir toutes LTA4H Anticorps
- LTA4H (Leukotriene A4 Hydrolase (LTA4H))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp LTA4H est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- LTA4 H antibody was raised against the middle region of LTA4
- Purification
- Affinity purified
- Immunogène
- LTA4 H antibody was raised using the middle region of LTA4 corresponding to a region with amino acids NACIALSQRWITAKEDDLNSFNATDLKDLSSHQLNEFLAQTLQRAPLPLG
- Top Product
- Discover our top product LTA4H Anticorps primaire
-
anti-Leukotriene A4 Hydrolase (LTA4H) (AA 135-272) antibody
LTA4H Reactivité: Souris WB, IHC, IP, ICC Hôte: Lapin Polyclonal unconjugated
anti-Leukotriene A4 Hydrolase (LTA4H) (AA 163-191) antibodyLTA4H Reactivité: Humain WB, IF, IHC (p) Hôte: Lapin Polyclonal RB17402 unconjugated
anti-Leukotriene A4 Hydrolase (LTA4H) antibodyLTA4H Reactivité: Humain WB, IF Hôte: Lapin Monoclonal unconjugated
anti-Leukotriene A4 Hydrolase (LTA4H) antibodyLTA4H Reactivité: Humain, Rat, Chien WB, IHC, IP Hôte: Souris Monoclonal 8F4 unconjugated
anti-Leukotriene A4 Hydrolase (LTA4H) (AA 107-311) antibodyLTA4H Reactivité: Humain WB, IHC, ELISA Hôte: Lapin Polyclonal unconjugated
anti-Leukotriene A4 Hydrolase (LTA4H) antibodyLTA4H Reactivité: Humain, Souris, Rat WB, IHC, ELISA Hôte: Lapin Polyclonal unconjugated
anti-Leukotriene A4 Hydrolase (LTA4H) antibodyLTA4H Reactivité: Humain, Souris WB, IF Hôte: Lapin Polyclonal unconjugated
anti-Leukotriene A4 Hydrolase (LTA4H) (AA 467-516) antibodyLTA4H Reactivité: Humain, Souris, Rat, Chien, Cheval, Lapin, Singe, Roussette (Chauve-souris) WB, IHC, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-Leukotriene A4 Hydrolase (LTA4H) (AA 101-150) antibodyLTA4H Reactivité: Humain, Souris, Rat, Chien, Cheval, Boeuf (Vache), Cobaye, Singe, Roussette (Chauve-souris), Porc WB Hôte: Lapin Polyclonal unconjugated
anti-Leukotriene A4 Hydrolase (LTA4H) antibodyLTA4H Reactivité: Humain WB, IHC, IF, IP, FACS Hôte: Souris Monoclonal 9G8 unconjugated
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
LTA4H Blocking Peptide, catalog no. 33R-6634, is also available for use as a blocking control in assays to test for specificity of this LTA4H antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LTA0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- LTA4H (Leukotriene A4 Hydrolase (LTA4H))
- Autre désignation
- LTA4H (LTA4H Produits)
- Synonymes
- anticorps LTA4H, anticorps zgc:85809, anticorps MGC78867, anticorps lta4h, anticorps MGC69197, anticorps LOC732953, anticorps DDBDRAFT_0191291, anticorps DDBDRAFT_0216768, anticorps DDB_0191291, anticorps DDB_0216768, anticorps AmpT, anticorps leukotriene A4 hydrolase, anticorps leukotriene A4 hydrolase L homeolog, anticorps Leukotriene A4 hydrolase, anticorps LTA4H, anticorps lta4h, anticorps lta4h.L, anticorps LOC732953, anticorps Shew185_1367, anticorps Sbal195_1406, anticorps XfasM23_0741, anticorps Sbal223_2977, anticorps lkhA, anticorps Lta4h
- Sujet
- LTA4H hydrolyzes an epoxide moiety of leukotriene A4 (LTA-4) to form leukotriene B4 (LTB-4). The enzyme also has some peptidase activity.
- Poids moléculaire
- 69 kDa (MW of target protein)
-
