LTA4H anticorps (Middle Region)

N° du produit ABIN634453

Cet anticorps Lapin Polyclonal détecte spécifiquement LTA4H dans WB. Il présente une réactivité avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour LTA4H anticorps (Middle Region) (ABIN634453)

Antigène: LTA4H (Leukotriene A4 Hydrolase (LTA4H))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LTA4H est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-LTA4H anticorps

Épitope: Middle Region

Specificité: LTA4 H antibody was raised against the middle region of LTA4

Purification: Affinity purified

Immunogène: LTA4 H antibody was raised using the middle region of LTA4 corresponding to a region with amino acids NACIALSQRWITAKEDDLNSFNATDLKDLSSHQLNEFLAQTLQRAPLPLG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LTA4H Blocking Peptide, (ABIN5614603), is also available for use as a blocking control in assays to test for specificity of this LTA4H antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LTA0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LTA4H

Antigène: LTA4H (Leukotriene A4 Hydrolase (LTA4H))

Autre désignation: LTA4H

Sujet: LTA4H hydrolyzes an epoxide moiety of leukotriene A4 (LTA-4) to form leukotriene B4 (LTB-4). The enzyme also has some peptidase activity.

Poids moléculaire: 69 kDa (MW of target protein)