PF4V1 anticorps (Middle Region)

N° du produit ABIN634485

Détail du produit anti-PF4V1 anticorps

Antigène: PF4V1 (Platelet Factor 4 Variant 1 (PF4V1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PF4V1 est non-conjugé

Application: Western Blotting (WB)

Specificité: PF4 V1 antibody was raised against the middle region of PF4 1

Purification: Affinity purified

Immunogène: PF4 V1 antibody was raised using the middle region of PF4 1 corresponding to a region with amino acids RPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQALLYKKIIKEHLE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PF4V1 Blocking Peptide, catalog no. 33R-8103, is also available for use as a blocking control in assays to test for specificity of this PF4V1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PF0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PF4V1

Antigène: PF4V1 (Platelet Factor 4 Variant 1 (PF4V1))

Autre désignation: PF4V1 (PF4V1 Produits)

Synonymes: anticorps PF4A, anticorps CXCL4L1, anticorps CXCL4V1, anticorps PF4-ALT, anticorps SCYB4V1, anticorps PF4V1, anticorps platelet factor 4 variant 1, anticorps PF4V1

Sujet: PF4V1 is the inhibitor of angiogenesis. PF4V1 is the inhibitor of endothelial cell chemotaxis (in vitro).

Poids moléculaire: 11 kDa (MW of target protein)