NPY1R anticorps (Middle Region)

N° du produit ABIN634513

Détail du produit anti-NPY1R anticorps

Antigène: NPY1R (Neuropeptide Y Receptor Y1 (NPY1R))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NPY1R est non-conjugé

Application: Western Blotting (WB)

Specificité: NPY1 R antibody was raised against the middle region of NPY1

Purification: Affinity purified

Immunogène: NPY1 R antibody was raised using the middle region of NPY1 corresponding to a region with amino acids TDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NPY1R Blocking Peptide, catalog no. 33R-9008, is also available for use as a blocking control in assays to test for specificity of this NPY1R antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NPY0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NPY1R

Antigène: NPY1R (Neuropeptide Y Receptor Y1 (NPY1R))

Autre désignation: NPY1R (NPY1R Produits)

Synonymes: anticorps NPY1-R, anticorps NPYR, anticorps NPY-1, anticorps NPY1R, anticorps si:dkey-253i9.3, anticorps Npyr, anticorps Y1-R, anticorps npy1r-A, anticorps npyr, anticorps neuropeptide Y receptor Y1, anticorps neuropeptide Y receptor Y1 S homeolog, anticorps NPY1R, anticorps Npy1r, anticorps npy1r, anticorps npy1r.S

Sujet: Neuropeptide Y (NPY) is one of the most abundant neuropeptides in the mammalian nervous system and exhibits a diverse range of important physiologic activities, including effects on psychomotor activity, food intake, regulation of central endocrine secretion, and potent vasoactive effects on the cardiovascular system. Two major subtypes of NPY (Y1 and Y2) have been defined by pharmacologic criteria. NPY receptors, such as NPY1R, have been identified in a variety of tissues, including brain, spleen, small intestine, kidney, testis, placenta, and aortic smooth muscle.

Poids moléculaire: 44 kDa (MW of target protein)

Pathways: Negative Regulation of Hormone Secretion, Feeding Behaviour