CD8B anticorps (N-Term)

N° du produit ABIN634561

Cet anticorps Lapin Polyclonal détecte spécifiquement CD8B dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour CD8B anticorps (N-Term) (ABIN634561)

Antigène: CD8B (CD8b Molecule (CD8B))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CD8B est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-CD8B anticorps

Épitope: N-Term

Specificité: CD8 B antibody was raised against the N terminal of CD8

Purification: Affinity purified

Immunogène: CD8 B antibody was raised using the N terminal of CD8 corresponding to a region with amino acids RIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CD8B Blocking Peptide, (ABIN5612764), is also available for use as a blocking control in assays to test for specificity of this CD8B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CD0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CD8B

Antigène: CD8B (CD8b Molecule (CD8B))

Autre désignation: CD8B

Sujet: The CD8 antigen is a cell surface glycoprotein found on most cytotoxic T lymphocytes that mediates efficient cell-cell interactions within the immune system. The CD8 antigen, acting as a coreceptor, and the T-cell receptor on the T lymphocyte recognise antigen displayed by an antigen presenting cell (APC) in the context of class I MHC molecules. The functional coreceptor is either a homodimer composed of two alpha chains, or a heterodimer composed of one alpha and one beta chain. Both alpha and beta chains share significant homology to immunoglobulin variable light chains. CD8B is the CD8 beta chain isoforms.

Poids moléculaire: 27 kDa (MW of target protein)

Pathways: TCR Signaling