FcRn anticorps (N-Term)

N° du produit ABIN634564

Détail du produit anti-FcRn anticorps

Antigène: FcRn (IgG receptor FcRn (FcRn))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FcRn est non-conjugé

Application: Western Blotting (WB)

Specificité: FCGRT antibody was raised against the N terminal of FCGRT

Purification: Affinity purified

Immunogène: FCGRT antibody was raised using the N terminal of FCGRT corresponding to a region with amino acids GWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLE

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FCGRT Blocking Peptide, catalog no. 33R-3667, is also available for use as a blocking control in assays to test for specificity of this FCGRT antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FCGRT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FcRn

Antigène: FcRn (IgG receptor FcRn (FcRn))

Autre désignation: FCGRT (FcRn Produits)

Synonymes: anticorps FCRN, anticorps alpha-chain, anticorps FcRn, anticorps Fc fragment of IgG receptor and transporter, anticorps Fc receptor, IgG, alpha chain transporter, anticorps FCGRT, anticorps Fcgrt

Sujet: FCGRT binds to the Fc region of monomeric immunoglobulins gamma. It mediates the uptake of IgG from milk. It plays a possible role in transfer of immunoglobulin G from mother to fetus.

Poids moléculaire: 40 kDa (MW of target protein)

Pathways: Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process