CXCL16 anticorps

N° du produit ABIN634580

Détail du produit anti-CXCL16 anticorps

Antigène: CXCL16 (Chemokine (C-X-C Motif) Ligand 16 (CXCL16))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CXCL16 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: CXCL16 antibody was raised using a synthetic peptide corresponding to a region with amino acids TARTSATVPVLCLLAIIFILTAALSYVLCKRRRGQSPQSSPDLPVHYIPV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CXCL16 Blocking Peptide, catalog no. 33R-8984, is also available for use as a blocking control in assays to test for specificity of this CXCL16 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CXCL16 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CXCL16

Antigène: CXCL16 (Chemokine (C-X-C Motif) Ligand 16 (CXCL16))

Autre désignation: CXCL16 (CXCL16 Produits)

Synonymes: anticorps CXCL16, anticorps 0910001K24Rik, anticorps AV290116, anticorps BB024863, anticorps CXCL16v1, anticorps CXCL16v2, anticorps SR-PSOX, anticorps Zmynd15, anticorps b2b498Clo, anticorps CXCLG16, anticorps SRPSOX, anticorps C-X-C motif chemokine ligand 16, anticorps chemokine (C-X-C motif) ligand 16, anticorps CXCL16, anticorps Cxcl16

Sujet: CXCL16 acts as a scavenger receptor on macrophages, which specifically binds to OxLDL (oxidized low density lipoprotein), suggesting that it may be involved in pathophysiology such as atherogenesis. It induces a strong chemotactic response and calcium mobilization.

Poids moléculaire: 29 kDa (MW of target protein)