BCAP31 anticorps (Middle Region)

N° du produit ABIN634582

Détail du produit anti-BCAP31 anticorps

Antigène: BCAP31 (B-Cell Receptor-Associated Protein 31 (BCAP31))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp BCAP31 est non-conjugé

Application: Western Blotting (WB)

Specificité: BCAP31 antibody was raised against the middle region of BCAP31

Purification: Affinity purified

Immunogène: BCAP31 antibody was raised using the middle region of BCAP31 corresponding to a region with amino acids STKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGPMDKKEE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

BCAP31 Blocking Peptide, catalog no. 33R-8871, is also available for use as a blocking control in assays to test for specificity of this BCAP31 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BCAP31 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur BCAP31

Antigène: BCAP31 (B-Cell Receptor-Associated Protein 31 (BCAP31))

Autre désignation: BCAP31 (BCAP31 Produits)

Synonymes: anticorps 6c6-ag, anticorps bap31, anticorps cdm, anticorps dxs1357e, anticorps BCAP31, anticorps Bap31, anticorps 6C6-AG, anticorps BAP31, anticorps CDM, anticorps DXS1357E, anticorps CALD1, anticorps caldesmon, anticorps si:bz30i22.4, anticorps si:rp71-30i22.4, anticorps zgc:56389, anticorps B-cell receptor associated protein 31, anticorps receptor-associated protein, anticorps lipopeptide mating pheromone precursor bap3-1, anticorps B cell receptor associated protein 31, anticorps B-cell receptor-associated protein 31, anticorps B-cell receptor associated protein 31 L homeolog, anticorps bcap31, anticorps BAP31, anticorps bap3-1, anticorps BCAP31, anticorps Bcap31, anticorps bcap31.L

Sujet: BCAP31 is a member of the B-cell receptor associated protein 31 superfamily. It is a multi-pass transmembrane protein of the endoplasmic reticulum that is involved in the anterograde transport of membrane proteins from the endoplasmic reticulum to the Golgi and in the caspase 8-mediated apoptosis. Microdeletions in this gene are associated with the contiguous ABCD1/DXS1375E deletion syndrome.

Poids moléculaire: 28 kDa (MW of target protein)

Pathways: Positive Regulation of Endopeptidase Activity