SGK1 anticorps (N-Term)

N° du produit ABIN634587

Cet anticorps anti-SGK1 est un anticorps Lapin Polyclonal détectant SGK1 dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour SGK1 anticorps (N-Term) (ABIN634587)

Antigène: SGK1 (serum/glucocorticoid Regulated Kinase 1 (SGK1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SGK1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SGK1 anticorps

Épitope: N-Term

Specificité: SGK1 antibody was raised against the N terminal of SGK1

Purification: Affinity purified

Immunogène: SGK1 antibody was raised using the N terminal of SGK1 corresponding to a region with amino acids ANPSPPPSPSQQINLGPSSNPHAKPSDFHFLKVIGKGSFGKVLLARHKAE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SGK1 Blocking Peptide, (ABIN936792), is also available for use as a blocking control in assays to test for specificity of this SGK1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SGK1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SGK1

Antigène: SGK1 (serum/glucocorticoid Regulated Kinase 1 (SGK1))

Autre désignation: SGK1

Sujet: This gene encodes a serine/threonine protein kinase that plays an important role in cellular stress response. This kinase activates certain potassium, sodium, and chloride channels.

Poids moléculaire: 49 kDa (MW of target protein)

Pathways: Signalisation MAPK, Signalisation Notch, Steroid Hormone Mediated Signaling Pathway