SGK1 anticorps (N-Term)
-
- Antigène Voir toutes SGK1 Anticorps
- SGK1 (serum/glucocorticoid Regulated Kinase 1 (SGK1))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SGK1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SGK1 antibody was raised against the N terminal of SGK1
- Purification
- Affinity purified
- Immunogène
- SGK1 antibody was raised using the N terminal of SGK1 corresponding to a region with amino acids ANPSPPPSPSQQINLGPSSNPHAKPSDFHFLKVIGKGSFGKVLLARHKAE
- Top Product
- Discover our top product SGK1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SGK1 Blocking Peptide, catalog no. 33R-1406, is also available for use as a blocking control in assays to test for specificity of this SGK1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SGK1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SGK1 (serum/glucocorticoid Regulated Kinase 1 (SGK1))
- Autre désignation
- SGK1 (SGK1 Produits)
- Synonymes
- anticorps SGK, anticorps Sgk, anticorps sgk-B, anticorps sgk2, anticorps cb1083, anticorps sgk, anticorps wu:fc20a09, anticorps sgk-A, anticorps sgk1, anticorps sgk1-a, anticorps sgk1-b, anticorps serum/glucocorticoid regulated kinase 1, anticorps Serine/threonine-protein kinase sgk-1, anticorps serum/glucocorticoid regulated kinase 1 S homeolog, anticorps serum/glucocorticoid regulated kinase 1 L homeolog, anticorps SGK1, anticorps Sgk1, anticorps sgk-1, anticorps sgk1.S, anticorps sgk1, anticorps sgk1.L
- Sujet
- This gene encodes a serine/threonine protein kinase that plays an important role in cellular stress response. This kinase activates certain potassium, sodium, and chloride channels.
- Poids moléculaire
- 49 kDa (MW of target protein)
- Pathways
- Signalisation MAPK, Signalisation Notch, Steroid Hormone Mediated Signaling Pathway
-