SLIT3 anticorps

N° du produit ABIN634630

Détail du produit anti-SLIT3 anticorps

Antigène: SLIT3 (Slit Homolog 3 (SLIT3))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLIT3 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: SLIT3 antibody was raised using a synthetic peptide corresponding to a region with amino acids PRRLANKRISQIKSKKFRCSGSEDYRSRFSSECFMDLVCPEKCRCEGTIV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLIT3 Blocking Peptide, catalog no. 33R-7343, is also available for use as a blocking control in assays to test for specificity of this SLIT3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLIT3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLIT3

Antigène: SLIT3 (Slit Homolog 3 (SLIT3))

Autre désignation: SLIT3 (SLIT3 Produits)

Synonymes: anticorps MGC146100, anticorps zgc:111911, anticorps MEGF5, anticorps SLIL2, anticorps SLIT1, anticorps Slit-3, anticorps slit2, anticorps Slil2, anticorps Slit1, anticorps Megf5, anticorps slit guidance ligand 3, anticorps slit homolog 3 (Drosophila), anticorps Slit3, anticorps slit3, anticorps SLIT3, anticorps LOC100125612, anticorps Slit3

Sujet: SLIT3 may act as molecular guidance cue in cellular migration, and function may be mediated by interaction with roundabout homolog receptors.

Poids moléculaire: 168 kDa (MW of target protein)

Pathways: Regulation of Cell Size