IGFALS anticorps (Middle Region)

N° du produit ABIN634631

Détail du produit anti-IGFALS anticorps

Antigène: IGFALS (Insulin-Like Growth Factor Binding Protein, Acid Labile Subunit (IGFALS))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IGFALS est non-conjugé

Application: Western Blotting (WB)

Specificité: IGFALS antibody was raised against the middle region of IGFALS

Purification: Affinity purified

Immunogène: IGFALS antibody was raised using the middle region of IGFALS corresponding to a region with amino acids PGLLGLRVLRLSHNAIASLRPRTFKDLHFLEELQLGHNRIRQLAERSFEG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

IGFALS Blocking Peptide, catalog no. 33R-7116, is also available for use as a blocking control in assays to test for specificity of this IGFALS antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IGFALS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur IGFALS

Antigène: IGFALS (Insulin-Like Growth Factor Binding Protein, Acid Labile Subunit (IGFALS))

Autre désignation: IGFALS (IGFALS Produits)

Synonymes: anticorps ALS, anticorps Albs, anticorps mKIAA4111, anticorps Als, anticorps insulin like growth factor binding protein acid labile subunit, anticorps insulin like growth factor binding protein acid labile subunit L homeolog, anticorps insulin-like growth factor binding protein, acid labile subunit, anticorps IGFALS, anticorps igfals.L, anticorps Igfals

Sujet: IGFALS is a serum protein that binds insulin-like growth factors, increasing their half-life and their vascular localization. Production of the encoded protein, which contains twenty leucine-rich repeats, is stimulated by growth hormone. Defects in IGFALS are a cause of acid-labile subunit deficiency, which maifests itself in a delayed and slow puberty.

Poids moléculaire: 63 kDa (MW of target protein)