GJA9 anticorps (Middle Region)

N° du produit ABIN634673

Détail du produit anti-GJA9 anticorps

Antigène: GJA9 (Gap Junction Protein, alpha 9, 59kDa (GJA9))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GJA9 est non-conjugé

Application: Western Blotting (WB)

Specificité: GJA9 antibody was raised against the middle region of GJA9

Purification: Affinity purified

Immunogène: GJA9 antibody was raised using the middle region of GJA9 corresponding to a region with amino acids IDGENNMRQSPQTVFSLPANCDWKPRWLRATWGSSTEHENRGSPPKGNLK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GJA9 Blocking Peptide, catalog no. 33R-3913, is also available for use as a blocking control in assays to test for specificity of this GJA9 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GJA9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GJA9

Antigène: GJA9 (Gap Junction Protein, alpha 9, 59kDa (GJA9))

Autre désignation: GJA9 (GJA9 Produits)

Synonymes: anticorps CX58, anticorps CX59, anticorps GJA10, anticorps gap junction protein alpha 9, anticorps GJA9

Sujet: Connexins, such as GJA9, are involved in the formation of gap junctions, intercellular conduits that directly connect the cytoplasms of contacting cells. Each gap junction channel is formed by docking of 2 hemichannels, each of which contains 6 connexin subunits.

Poids moléculaire: 59 kDa (MW of target protein)