SIGLEC12 anticorps (N-Term)

N° du produit ABIN634721

Détail du produit anti-SIGLEC12 anticorps

Antigène: SIGLEC12 (Sialic Acid Binding Ig-Like Lectin 12 (SIGLEC12))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SIGLEC12 est non-conjugé

Application: Western Blotting (WB)

Specificité: SIGLEC12 antibody was raised against the N terminal of SIGLEC12

Purification: Affinity purified

Immunogène: SIGLEC12 antibody was raised using the N terminal of SIGLEC12 corresponding to a region with amino acids DTRESDAGTYVFCVERGNMKWNYKYDQLSVNVTASQDLLSRYRLEVPESV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SIGLEC12 Blocking Peptide, catalog no. 33R-2208, is also available for use as a blocking control in assays to test for specificity of this SIGLEC12 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SIGLEC12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SIGLEC12

Antigène: SIGLEC12 (Sialic Acid Binding Ig-Like Lectin 12 (SIGLEC12))

Autre désignation: SIGLEC12 (SIGLEC12 Produits)

Synonymes: anticorps S2V, anticorps SIGLECL1, anticorps SLG, anticorps Siglec-XII, anticorps sialic acid binding Ig like lectin 12 (gene/pseudogene), anticorps sialic acid binding Ig like lectin 12, anticorps sialic acid binding Ig-like lectin 12, anticorps SIGLEC12

Sujet: Sialic acid-binding immunoglobulin-like lectins (SIGLECs) are a family of cell surface proteins belonging to the immunoglobulin superfamily. They mediate protein-carbohydrate interactions by selectively binding to different sialic acid moieties present on glycolipids and glycoproteins. SIGLEC12 is a member of the SIGLEC3-like subfamily of SIGLECs. SIGLEC12, upon tyrosine phosphorylation, has been shown to recruit the Src homology 2 domain-containing protein-tyrosine phosphatases SHP1 and SHP2.

Poids moléculaire: 63 kDa (MW of target protein)