PCDHA3 anticorps (N-Term)

N° du produit ABIN634741

Détail du produit anti-PCDHA3 anticorps

Antigène: PCDHA3 (Protocadherin alpha 3 (PCDHA3))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PCDHA3 est non-conjugé

Application: Western Blotting (WB)

Specificité: PCDHA3 antibody was raised against the N terminal of PCDHA3

Purification: Affinity purified

Immunogène: PCDHA3 antibody was raised using the N terminal of PCDHA3 corresponding to a region with amino acids LFSWREDPGAQCLLLSLLLLAASEVGSGQLHYSVSEEAKHGTFVGRIAQD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PCDHA3 Blocking Peptide, catalog no. 33R-4950, is also available for use as a blocking control in assays to test for specificity of this PCDHA3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCDHA3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PCDHA3

Antigène: PCDHA3 (Protocadherin alpha 3 (PCDHA3))

Autre désignation: PCDHA3 (PCDHA3 Produits)

Synonymes: anticorps PCDH-ALPHA3, anticorps mKIAA0345, anticorps PCDHA2, anticorps PCDHA3, anticorps PCDHA4, anticorps Pcdha3, anticorps protocadherin alpha 3, anticorps protocadherin alpha-3, anticorps PCDHA3, anticorps Pcdha3, anticorps pcdha3, anticorps LOC100713314

Sujet: PCDHA3 is a single-pass type I membrane protein. It contains 6 cadherin domains. PCDHA3 is a potential calcium-dependent cell-adhesion protein. It may be involved in the establishment and maintenance of specific neuronal connections in the brain.

Poids moléculaire: 99 kDa (MW of target protein)