FGF13 anticorps (Middle Region)

N° du produit ABIN634781

Détail du produit anti-FGF13 anticorps

Antigène: FGF13 (Fibroblast Growth Factor 13 (FGF13))

Épitope: Middle Region

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FGF13 est non-conjugé

Application: Western Blotting (WB)

Specificité: FGF13 antibody was raised against the middle region of FGF13

Purification: Affinity purified

Immunogène: FGF13 antibody was raised using the middle region of FGF13 corresponding to a region with amino acids TKLYSRQGYHLQLQADGTIDGTKDEDSTYTLFNLIPVGLRVVAIQGVQTK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FGF13 Blocking Peptide, catalog no. 33R-9144, is also available for use as a blocking control in assays to test for specificity of this FGF13 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FGF13 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FGF13

Antigène: FGF13 (Fibroblast Growth Factor 13 (FGF13))

Autre désignation: FGF13 (FGF13 Produits)

Synonymes: anticorps FGF13, anticorps fgf2, anticorps fhf2, anticorps fgf13, anticorps FGF-13, anticorps xFGF13, anticorps FGF2, anticorps FHF-2, anticorps FHF2, anticorps Fhf2, anticorps zgc:101784, anticorps fibroblast growth factor 13, anticorps fibroblast growth factor 13 L homeolog, anticorps fibroblast growth factor 13a, anticorps FGF13, anticorps fgf13, anticorps fgf13.L, anticorps Fgf13, anticorps fgf13a

Sujet: The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth, and invasion.

Poids moléculaire: 27 kDa (MW of target protein)

Pathways: Regulation of Cell Size