CSHL1 anticorps (C-Term)

N° du produit ABIN634789

Détail du produit anti-CSHL1 anticorps

Antigène: CSHL1 (Chorionic Somatomammotropin Hormone-Like 1 (CSHL1))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CSHL1 est non-conjugé

Application: Western Blotting (WB)

Specificité: CSHL1 antibody was raised against the C terminal of CSHL1

Purification: Affinity purified

Immunogène: CSHL1 antibody was raised using the C terminal of CSHL1 corresponding to a region with amino acids GQTLKQTYSKFDTNSHNHDALLKNYGLLHCFRKDMDKVETFLRMVQCRSV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CSHL1 Blocking Peptide, catalog no. 33R-3515, is also available for use as a blocking control in assays to test for specificity of this CSHL1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSHL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CSHL1

Antigène: CSHL1 (Chorionic Somatomammotropin Hormone-Like 1 (CSHL1))

Autre désignation: CSHL1 (CSHL1 Produits)

Synonymes: anticorps CSHL1, anticorps PL-D, anticorps CS-5, anticorps CSHP1, anticorps CSL, anticorps hCS-L, anticorps placental lactogen PL-D, anticorps chorionic somatomammotropin hormone like 1, anticorps PL-D, anticorps CSHL1

Sujet: CSHL1 is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. This particular family member is expressed in placental villi, although it was originally thought to be a pseudogene. In fact, alternative splicing suggests that the majority of the transcripts would be unable to express a secreted protein.

Poids moléculaire: 20 kDa (MW of target protein)