Neuregulin 1 anticorps (Middle Region)

N° du produit ABIN634812

Cet anticorps anti-Neuregulin 1 Polyclonal Lapin (ABIN634812) détecte spécifiquement Neuregulin 1 dans WB. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour Neuregulin 1 anticorps (Middle Region) (ABIN634812)

Antigène: Neuregulin 1 (NRG1)

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Neuregulin 1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Neuregulin 1 anticorps

Épitope: Middle Region

Specificité: NRG1 antibody was raised against the middle region of NRG1

Purification: Affinity purified

Immunogène: NRG1 antibody was raised using the middle region of NRG1 corresponding to a region with amino acids SEVQVTVQGDKAVVSFEPSAAPTPKNRIFAFSFLPSTAPSFPSPTRNPEV

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NRG1 Blocking Peptide, (ABIN5615062), is also available for use as a blocking control in assays to test for specificity of this NRG1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NRG1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Neuregulin 1

Antigène: Neuregulin 1 (NRG1)

Autre désignation: NRG1

Sujet: Neuregulin 1 (NRG1) was originally identified as a 44 kDa glycoprotein that interacts with the NEU/ERBB2 receptor tyrosine kinase to increase its phosphorylation on tyrosine residues. It is known that an extraordinary variety of different isoforms are produced from the NRG1 gene by alternative splicing.

Poids moléculaire: 32 kDa (MW of target protein)

Pathways: Signalisation RTK, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Regulation of Muscle Cell Differentiation