Motilin anticorps (Middle Region)

N° du produit ABIN634816

Détail du produit anti-Motilin anticorps

Antigène: Motilin (MLN)

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Motilin est non-conjugé

Application: Western Blotting (WB)

Specificité: Motilin antibody was raised against the middle region of MLN

Purification: Affinity purified

Immunogène: Motilin antibody was raised using the middle region of MLN corresponding to a region with amino acids LQRMQEKERNKGQKKSLSVWQRSGEEGPVDPAEPIREEENEMIKLTAPLE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Motilin Blocking Peptide, catalog no. 33R-5335, is also available for use as a blocking control in assays to test for specificity of this Motilin antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MLN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Motilin

Antigène: Motilin (MLN)

Autre désignation: Motilin (MLN Produits)

Sujet: This gene encodes a small peptide hormone that is secreted by cells of the small intestine to regulate gastrointestinal contractions and motility.

Poids moléculaire: 3 kDa (MW of target protein)

Pathways: Hormone Activity