MMEL1 anticorps (Middle Region)

N° du produit ABIN634822

Détail du produit anti-MMEL1 anticorps

Antigène: MMEL1 (Membrane Metallo-Endopeptidase-Like 1 (MMEL1))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MMEL1 est non-conjugé

Application: Western Blotting (WB)

Specificité: MMEL1 antibody was raised against the middle region of MMEL1

Purification: Affinity purified

Immunogène: MMEL1 antibody was raised using the middle region of MMEL1 corresponding to a region with amino acids EVVVYGIPYLQNLENIIDTYSARTIQNYLVWRLVLDRIGSLSQRFKDTRV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MMEL1 Blocking Peptide, catalog no. 33R-2809, is also available for use as a blocking control in assays to test for specificity of this MMEL1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MMEL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MMEL1

Antigène: MMEL1 (Membrane Metallo-Endopeptidase-Like 1 (MMEL1))

Autre désignation: MMEL1 (MMEL1 Produits)

Synonymes: anticorps MMEL2, anticorps NEP2, anticorps NEPII, anticorps NL1, anticorps NL2, anticorps SEP, anticorps Mell1, anticorps Nl1, anticorps MMEL1, anticorps membrane metalloendopeptidase like 1, anticorps membrane metallo-endopeptidase-like 1, anticorps MMEL1, anticorps Mmel1, anticorps mmel1

Sujet: MMEL1 is a member of the neutral endopeptidase (NEP) or membrane metallo-endopeptidase (MME) family. Family members play important roles in pain perception, arterial pressure regulation, phosphate metabolism and homeostasis.

Poids moléculaire: 88 kDa (MW of target protein)