OR6C75 anticorps (Middle Region)

N° du produit ABIN634832

Détail du produit anti-OR6C75 anticorps

Antigène: OR6C75 (Olfactory Receptor, Family 6, Subfamily C, Member 75 (OR6C75))

Épitope: Middle Region

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp OR6C75 est non-conjugé

Application: Western Blotting (WB)

Specificité: OR6 C75 antibody was raised against the middle region of OR6 75

Purification: Affinity purified

Immunogène: OR6 C75 antibody was raised using the middle region of OR6 75 corresponding to a region with amino acids SCIFMYIKTSARERVTLSKGVAVLNTSVAPLLNPFIYTLRNKQVKQAFKS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

OR6C75 Blocking Peptide, catalog no. 33R-8330, is also available for use as a blocking control in assays to test for specificity of this OR6C75 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OR0 75 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur OR6C75

Antigène: OR6C75 (Olfactory Receptor, Family 6, Subfamily C, Member 75 (OR6C75))

Autre désignation: OR6C75 (OR6C75 Produits)

Synonymes: anticorps olfactory receptor, family 6, subfamily C, member 75, anticorps olfactory receptor family 6 subfamily C member 75, anticorps OR6C75

Sujet: Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals.

Poids moléculaire: 35 kDa (MW of target protein)