ABCE1 anticorps
-
- Antigène Voir toutes ABCE1 Anticorps
- ABCE1 (ATP-Binding Cassette, Sub-Family E (OABP), Member 1 (ABCE1))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ABCE1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- ABCE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LAGMNKFLSQLEITFRRDPNNYRPRINKLNSIKDVEQKKSGNYFFLDD
- Top Product
- Discover our top product ABCE1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ABCE1 Blocking Peptide, catalog no. 33R-4770, is also available for use as a blocking control in assays to test for specificity of this ABCE1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCE1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ABCE1 (ATP-Binding Cassette, Sub-Family E (OABP), Member 1 (ABCE1))
- Autre désignation
- ABCE1 (ABCE1 Produits)
- Synonymes
- anticorps ABCE1, anticorps DDBDRAFT_0188931, anticorps DDBDRAFT_0191227, anticorps DDB_0188931, anticorps DDB_0191227, anticorps abce1, anticorps MGC69546, anticorps DKFZp469K1416, anticorps ABC38, anticorps OABP, anticorps RLI, anticorps RNASEL1, anticorps RNASELI, anticorps RNS4I, anticorps C79080, anticorps Oabp, anticorps RNS41, anticorps Rnaseli, anticorps wu:fb34c09, anticorps wu:fe47b01, anticorps wu:fi09g07, anticorps zgc:111906, anticorps zgc:56045, anticorps Rns4i, anticorps ATP binding cassette subfamily E member 1, anticorps 4Fe-4S ferredoxin, iron-sulfur binding domain-containing protein, anticorps ATP-binding cassette sub-family E member 1, anticorps RNAse L inhibitor, anticorps RNase L inhibitor, anticorps ribosome biogenesis/translation initiation ATPase RLI, anticorps ATP-binding cassette, sub-family E (OABP), member 1, anticorps ATP binding cassette subfamily E member 1 S homeolog, anticorps ABCE1, anticorps abcE1, anticorps LOC100184673, anticorps LOC100213121, anticorps abce1, anticorps TP04_0855, anticorps PVX_115370, anticorps TERMP_RS03360, anticorps Abce1, anticorps abce1.S
- Sujet
- ABCE1 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the OABP subfamily. Alternatively referred to as the RNase L inhibitor, this protein functions to block the activity of ribonuclease L. Activation of ribonuclease L leads to inhibition of protein synthesis in the 2-5A/RNase L system, the central pathway for viral interferon action.
- Poids moléculaire
- 67 kDa (MW of target protein)
-