ABCE1 anticorps

N° du produit ABIN634841

Détail du produit anti-ABCE1 anticorps

Antigène: ABCE1 (ATP-Binding Cassette, Sub-Family E (OABP), Member 1 (ABCE1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ABCE1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: ABCE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LAGMNKFLSQLEITFRRDPNNYRPRINKLNSIKDVEQKKSGNYFFLDD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ABCE1 Blocking Peptide, catalog no. 33R-4770, is also available for use as a blocking control in assays to test for specificity of this ABCE1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCE1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ABCE1

Antigène: ABCE1 (ATP-Binding Cassette, Sub-Family E (OABP), Member 1 (ABCE1))

Autre désignation: ABCE1 (ABCE1 Produits)

Synonymes: anticorps ABCE1, anticorps DDBDRAFT_0188931, anticorps DDBDRAFT_0191227, anticorps DDB_0188931, anticorps DDB_0191227, anticorps abce1, anticorps MGC69546, anticorps DKFZp469K1416, anticorps ABC38, anticorps OABP, anticorps RLI, anticorps RNASEL1, anticorps RNASELI, anticorps RNS4I, anticorps C79080, anticorps Oabp, anticorps RNS41, anticorps Rnaseli, anticorps wu:fb34c09, anticorps wu:fe47b01, anticorps wu:fi09g07, anticorps zgc:111906, anticorps zgc:56045, anticorps Rns4i, anticorps ATP binding cassette subfamily E member 1, anticorps 4Fe-4S ferredoxin, iron-sulfur binding domain-containing protein, anticorps ATP-binding cassette sub-family E member 1, anticorps RNAse L inhibitor, anticorps RNase L inhibitor, anticorps ribosome biogenesis/translation initiation ATPase RLI, anticorps ATP-binding cassette, sub-family E (OABP), member 1, anticorps ATP binding cassette subfamily E member 1 S homeolog, anticorps ABCE1, anticorps abcE1, anticorps LOC100184673, anticorps LOC100213121, anticorps abce1, anticorps TP04_0855, anticorps PVX_115370, anticorps TERMP_RS03360, anticorps Abce1, anticorps abce1.S

Sujet: ABCE1 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the OABP subfamily. Alternatively referred to as the RNase L inhibitor, this protein functions to block the activity of ribonuclease L. Activation of ribonuclease L leads to inhibition of protein synthesis in the 2-5A/RNase L system, the central pathway for viral interferon action.

Poids moléculaire: 67 kDa (MW of target protein)