SLC36A2 anticorps
-
- Antigène Voir toutes SLC36A2 Anticorps
- SLC36A2 (Solute Carrier Family 36 (Proton/amino Acid Symporter), Member 2 (SLC36A2))
- Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC36A2 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- SLC36 A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TFLDESPSESAGLKKTKGITVFQALIHLVKGNMGTGILGLPLAVKNAGIL
- Top Product
- Discover our top product SLC36A2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC36A2 Blocking Peptide, catalog no. 33R-9067, is also available for use as a blocking control in assays to test for specificity of this SLC36A2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLC36A2 (Solute Carrier Family 36 (Proton/amino Acid Symporter), Member 2 (SLC36A2))
- Autre désignation
- SLC36A2 (SLC36A2 Produits)
- Synonymes
- anticorps DKFZp469P1320, anticorps PAT2, anticorps TRAMD1, anticorps A530067G19Rik, anticorps Tramd1, anticorps Pat2, anticorps solute carrier family 36 member 2, anticorps solute carrier family 36 (proton/amino acid symporter), member 2, anticorps SLC36A2, anticorps Slc36a2
- Sujet
- SLC36A2 is involved in a pH-dependent electrogenic neuronal transport and sequestration of small amino acids amino acids such as glycine, alanine and proline. SLC36A2 is inhibited by sarcosine.
- Poids moléculaire
- 53 kDa (MW of target protein)
- Pathways
- Proton Transport
-