SYNGR2 anticorps (N-Term)
-
- Antigène Voir toutes SYNGR2 Anticorps
- SYNGR2 (Synaptogyrin 2 (SYNGR2))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SYNGR2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Synaptogyrin 2 antibody was raised against the N terminal of SYNGR2
- Purification
- Affinity purified
- Immunogène
- Synaptogyrin 2 antibody was raised using the N terminal of SYNGR2 corresponding to a region with amino acids ESGAYGAAKAGGSFDLRRFLTQPQVVARAVCLVFALIVFSCIYGEGYSNA
- Top Product
- Discover our top product SYNGR2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Synaptogyrin 2 Blocking Peptide, catalog no. 33R-2727, is also available for use as a blocking control in assays to test for specificity of this Synaptogyrin 2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SYNGR2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SYNGR2 (Synaptogyrin 2 (SYNGR2))
- Autre désignation
- Synaptogyrin 2 (SYNGR2 Produits)
- Synonymes
- anticorps Clast2, anticorps cellugyrin, anticorps syngr2, anticorps MGC89604, anticorps Cellugyrin, anticorps synaptogyrin 2, anticorps synaptogyrin 2 S homeolog, anticorps SYNGR2, anticorps Syngr2, anticorps syngr2.S, anticorps syngr2
- Sujet
- SYNGR2 is an integral membrane protein containing four transmembrane regions and a C-terminal cytoplasmic tail that is tyrosine phosphorylated. The exact function of this protein is unclear, but studies of a similar rat protein suggest that it may play a role in regulating membrane traffic in non-neuronal cells.
- Poids moléculaire
- 25 kDa (MW of target protein)
-