ATP2B3 anticorps (N-Term)

N° du produit ABIN634900

Détail du produit anti-ATP2B3 anticorps

Antigène: ATP2B3 (ATPase, Ca++ Transporting, Plasma Membrane 3 (ATP2B3))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ATP2B3 est non-conjugé

Application: Western Blotting (WB)

Specificité: ATP2 B3 antibody was raised against the N terminal of ATP2 3

Purification: Affinity purified

Immunogène: ATP2 B3 antibody was raised using the N terminal of ATP2 3 corresponding to a region with amino acids GDMANSSIEFHPKPQQQRDVPQAGGFGCTLAELRTLMELRGAEALQKIEE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ATP2B3 Blocking Peptide, catalog no. 33R-3204, is also available for use as a blocking control in assays to test for specificity of this ATP2B3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ATP2B3

Antigène: ATP2B3 (ATPase, Ca++ Transporting, Plasma Membrane 3 (ATP2B3))

Autre désignation: ATP2B3 (ATP2B3 Produits)

Synonymes: anticorps PMCA3, anticorps PMCA3a, anticorps SCAX1, anticorps atp2b3, anticorps pmca3a, anticorps zgc:92885, anticorps 6430519O13Rik, anticorps Pmca3, anticorps ATPase plasma membrane Ca2+ transporting 3, anticorps ATPase, Ca++ transporting, plasma membrane 3a, anticorps ATPase, Ca++ transporting, plasma membrane 3, anticorps plasma membrane calcium-transporting ATPase 2, anticorps ATP2B3, anticorps atp2b3a, anticorps Atp2b3, anticorps atp2b3, anticorps LOC100639471

Sujet: ATP2B3 gene belongs to the family of P-type primary ion transport ATPases characterized by the formation of an aspartyl phosphate intermediate during the reaction cycle. These enzymes remove bivalent calcium ions from eukaryotic cells against very large concentration gradients and play a critical role in intracellular calcium homeostasis.

Poids moléculaire: 134 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process