LFNG anticorps (N-Term)

N° du produit ABIN634905

Détail du produit anti-LFNG anticorps

Antigène: LFNG (LFNG O-Fucosylpeptide 3-beta-N-Acetylglucosaminyltransferase (LFNG))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LFNG est non-conjugé

Application: Western Blotting (WB)

Specificité: LFNG antibody was raised against the N terminal of LFNG

Purification: Affinity purified

Immunogène: LFNG antibody was raised using the N terminal of LFNG corresponding to a region with amino acids LSEYFSLLTRARRDAGPPPGAAPRPADGHPRPLAEPLAPRDVFIAVKTTK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LFNG Blocking Peptide, catalog no. 33R-5423, is also available for use as a blocking control in assays to test for specificity of this LFNG antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LFNG antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LFNG

Antigène: LFNG (LFNG O-Fucosylpeptide 3-beta-N-Acetylglucosaminyltransferase (LFNG))

Autre désignation: LFNG (LFNG Produits)

Synonymes: anticorps SCDO3, anticorps AW061165, anticorps id:ibd2614, anticorps id:ibd5029, anticorps id:ibd5138, anticorps l-fng, anticorps wu:fc69h02, anticorps wu:fi34c01, anticorps LFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase, anticorps LFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase S homeolog, anticorps LFNG, anticorps Lfng, anticorps lfng.S, anticorps lfng

Sujet: LFNG is a member of the glycosyltransferase superfamily. It is a single-pass type II Golgi membrane protein that functions as a fucose-specific glycosyltransferase, adding an N-acetylglucosamine to the fucose residue of a group of signaling receptors involved in regulating cell fate decisions during development. Mutations in the gene that encodes this protein have been associated with autosomal recessive spondylocostal dysostosis 3.

Poids moléculaire: 39 kDa (MW of target protein)

Pathways: Signalisation Notch