TGFB2 anticorps (Middle Region)

N° du produit ABIN634909

Détail du produit anti-TGFB2 anticorps

Antigène: TGFB2 (Transforming Growth Factor, beta 2 (TGFB2))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TGFB2 est non-conjugé

Application: Western Blotting (WB)

Specificité: TGF beta 2 antibody was raised against the middle region of TGFB2

Purification: Affinity purified

Immunogène: TGF beta 2 antibody was raised using the middle region of TGFB2 corresponding to a region with amino acids NLVKAEFRVFRLQNPKARVPEQRIELYQILKSKDLTSPTQRYIDSKVVKT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TGF beta 2 Blocking Peptide, catalog no. 33R-6785, is also available for use as a blocking control in assays to test for specificity of this TGF beta 2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TGFB2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TGFB2

Antigène: TGFB2 (Transforming Growth Factor, beta 2 (TGFB2))

Autre désignation: TGF beta 2 (TGFB2 Produits)

Synonymes: anticorps LDS4, anticorps TGF-beta2, anticorps tgf-beta2, anticorps tgfb2-A, anticorps BB105277, anticorps Tgf-beta2, anticorps Tgfb-2, anticorps TGF-beta 2, anticorps Tgfbr2T, anticorps TGFB2, anticorps TGFbeta2, anticorps MGF, anticorps TGF-B2, anticorps transforming growth factor beta 2, anticorps transforming growth factor beta 2 L homeolog, anticorps transforming growth factor, beta 2, anticorps transforming growth factor, beta receptor 2, anticorps TGFB2, anticorps tgfb2.L, anticorps Tgfb2, anticorps Tgfbr2, anticorps tgfb2

Sujet: This gene encodes a member of the transforming growth factor beta (TGFB) family of cytokines, which are multifunctional peptides that regulate proliferation, differentiation, adhesion, migration, and other functions in many cell types by transducing their signal through combinations of transmembrane type I and type II receptors (TGFBR1 and TGFBR2) and their downstream effectors, the SMAD proteins. Disruption of the TGFB/SMAD pathway has been implicated in a variety of human cancers.

Poids moléculaire: 46 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization, Production of Molecular Mediator of Immune Response, Protein targeting to Nucleus