GIMAP5 anticorps (Middle Region)

N° du produit ABIN634956

Détail du produit anti-GIMAP5 anticorps

Antigène: GIMAP5 (GTPase, IMAP Family Member 5 (GIMAP5))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GIMAP5 est non-conjugé

Application: Western Blotting (WB)

Specificité: GIMAP5 antibody was raised against the middle region of GIMAP5

Purification: Affinity purified

Immunogène: GIMAP5 antibody was raised using the middle region of GIMAP5 corresponding to a region with amino acids CERRYCAFNNWGSVEEQRQQQAELLAVIERLGREREGSFHSNDLFLDAQL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GIMAP5 Blocking Peptide, catalog no. 33R-1678, is also available for use as a blocking control in assays to test for specificity of this GIMAP5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GIMAP5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GIMAP5

Antigène: GIMAP5 (GTPase, IMAP Family Member 5 (GIMAP5))

Autre désignation: GIMAP5 (GIMAP5 Produits)

Synonymes: anticorps HIMAP3, anticorps IAN-5, anticorps IAN4, anticorps IAN4L1, anticorps IAN5, anticorps IMAP3, anticorps IROD, anticorps Ian4l1, anticorps Ian5, anticorps D630024P16, anticorps E230026N22Rik, anticorps GTPase, IMAP family member 5, anticorps GTPase IMAP family member 5, anticorps GIMAP5, anticorps Gimap5, anticorps LOC463896

Sujet: GIMAP5 belongs to the GTP-binding superfamily and to the immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins. In humans, the IAN subfamily genes are located in a cluster at 7q36.1.

Poids moléculaire: 35 kDa (MW of target protein)

Pathways: Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response