Cyclin M2 anticorps (Middle Region)

N° du produit ABIN634969

Détail du produit anti-Cyclin M2 anticorps

Antigène: Cyclin M2 (CNNM2)

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Cyclin M2 est non-conjugé

Application: Western Blotting (WB)

Specificité: Cyclin M2 antibody was raised against the middle region of CNNM2

Purification: Affinity purified

Immunogène: Cyclin M2 antibody was raised using the middle region of CNNM2 corresponding to a region with amino acids EIIKSEILDETDLYTDNRTKKKVAHRERKQDFSAFKQTDSEMKVKISPQL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Cyclin M2 Blocking Peptide, catalog no. 33R-2471, is also available for use as a blocking control in assays to test for specificity of this Cyclin M2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CNNM2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Cyclin M2

Antigène: Cyclin M2 (CNNM2)

Autre désignation: Cyclin M2 (CNNM2 Produits)

Synonymes: anticorps acdp4, anticorps cnnm4, anticorps ACDP2, anticorps AU015877, anticorps AW048635, anticorps Acdp2, anticorps Clp2, anticorps cyclin and CBS domain divalent metal cation transport mediator 2, anticorps metal transporter CNNM2, anticorps cyclin M2, anticorps CNNM2, anticorps cnnm2, anticorps LOC100059801, anticorps Cnnm2

Sujet: CNNM2 is a divalent metal cation transporter. CNNM2 mediates transport of divalent metal cations in an order of Mg2+ > Co2+ > Mn2+ > Sr2+ > Ba2+ > Cu2+ > Fe2+.

Poids moléculaire: 96 kDa (MW of target protein)