ARV1 anticorps
-
- Antigène Voir toutes ARV1 Anticorps
- ARV1 (ARV1 Homolog (ARV1))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ARV1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- ARV1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QAIRVTLNINRKLSFLAVLSGLLLESIMVYFFQSMEWDVGSDYAIFKSQD
- Top Product
- Discover our top product ARV1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ARV1 Blocking Peptide, catalog no. 33R-7461, is also available for use as a blocking control in assays to test for specificity of this ARV1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARV1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ARV1 (ARV1 Homolog (ARV1))
- Autre désignation
- ARV1 (ARV1 Produits)
- Synonymes
- anticorps 1110067L22Rik, anticorps AI461928, anticorps AW121084, anticorps ARV1 homolog, fatty acid homeostasis modulator, anticorps ARV1, anticorps Arv1
- Sujet
- ARV1 may act as a mediator of sterol homeostasis.
- Poids moléculaire
- 31 kDa (MW of target protein)
-