ARV1 anticorps

N° du produit ABIN635026

Détail du produit anti-ARV1 anticorps

Antigène: ARV1 (ARV1 Homolog (ARV1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ARV1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: ARV1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QAIRVTLNINRKLSFLAVLSGLLLESIMVYFFQSMEWDVGSDYAIFKSQD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ARV1 Blocking Peptide, catalog no. 33R-7461, is also available for use as a blocking control in assays to test for specificity of this ARV1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARV1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ARV1

Antigène: ARV1 (ARV1 Homolog (ARV1))

Autre désignation: ARV1 (ARV1 Produits)

Synonymes: anticorps 1110067L22Rik, anticorps AI461928, anticorps AW121084, anticorps ARV1 homolog, fatty acid homeostasis modulator, anticorps ARV1, anticorps Arv1

Sujet: ARV1 may act as a mediator of sterol homeostasis.

Poids moléculaire: 31 kDa (MW of target protein)